PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC037330.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bHLH
Protein Properties Length: 219aa    MW: 24995.7 Da    PI: 9.2629
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC037330.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH406.8e-133688155
                  CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
           HLH  1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                  ++++h e+Er+RR+++ s  + Lr+ lP  +   ++K s ++   +Av+YIk+L+
  EcC037330.10 36 KKKKHREVERQRRQEMASLCASLRSKLPLEF--IKGKRSTSDHMNEAVNYIKHLR 88
                  6899*************************65..********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474595.23E-1334104IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.79E-103491No hitNo description
PROSITE profilePS5088813.9353587IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.6E-103687IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.7E-1036103IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.6E-44193IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MESSSSIFKV VRNRRRKFSV TNYHERAGQD GDHGDKKKKH REVERQRRQE MASLCASLRS  60
KLPLEFIKGK RSTSDHMNEA VNYIKHLRAK IGELGFKRDE LKSIHSLAAL GSPSSNSSCL  120
TTFTVNLCCE IVEIVISQSI REKDFLLSTV LDLLLQQGLD VVSCFSSQAY DKIVHTIRCE  180
LVSNLSYIYS KYAGLQSSCQ SFVFLLNIFR VEPFIQHDL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061822.11e-112PREDICTED: transcription factor bHLH36-like
TrEMBLA0A059DK501e-107A0A059DK50_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44792754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51780.17e-27bHLH family protein